PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009610329.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 309aa    MW: 33385.7 Da    PI: 5.4509
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009610329.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.65.2e-33164221259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +Dgy+WrKYGqK vk+s+fprsYYrCt ++C+vkk+vers+edp++v++tYeg+H h+
  XP_009610329.1 164 EDGYRWRKYGQKAVKNSPFPRSYYRCTNTKCTVKKRVERSSEDPSIVITTYEGQHCHH 221
                     8******************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.806.1E-34148222IPR003657WRKY domain
SuperFamilySSF1182901.83E-28155221IPR003657WRKY domain
PROSITE profilePS5081129.643158223IPR003657WRKY domain
SMARTSM007744.5E-39163222IPR003657WRKY domain
PfamPF031066.5E-26164221IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MDDKDKVDDP LKSAAEFAAT ESSWSLGAES DNVYSFFGNT DRDSSILNEF GWNFPPSEAA  60
GDKDVVGGSG GAGGFDRIDD DLAGNSSTTP SASATEVPAT GKITDEPLSS SCSDDPPEKS  120
TASGGSSASR PPSDTASKVK KKGQKRIRQP RFAFMTKSEV DHLEDGYRWR KYGQKAVKNS  180
PFPRSYYRCT NTKCTVKKRV ERSSEDPSIV ITTYEGQHCH HTVGFPRGGL ISHEAAFTTH  240
QLTPLASQFY LPAGVQYPQE VPMSAPESRQ IPGESAEARR LPETSQPANQ LPTDEGLLGD  300
IVPPGMRSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A7e-26153220774Probable WRKY transcription factor 4
2lex_A7e-26153220774Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00067PBMTransfer from AT1G69310Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0139331e-160BT013933.1 Lycopersicon esculentum clone 132931F, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009610329.10.0PREDICTED: probable WRKY transcription factor 57 isoform X1
RefseqXP_009610330.10.0PREDICTED: probable WRKY transcription factor 57 isoform X2
RefseqXP_016496557.10.0PREDICTED: probable WRKY transcription factor 57
TrEMBLK4BXX21e-148K4BXX2_SOLLC; Uncharacterized protein
STRINGSolyc05g012500.2.11e-147(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA80312228
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69310.24e-69WRKY DNA-binding protein 57